WB (Western Blot)
(WB Suggested Anti-ARL17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Rabbit ARL17 Polyclonal Antibody | anti-ARL17B antibody
ARL17 antibody - middle region
Gene Names
ARL17B; ARL17; ARL17A
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARL17, Antibody; ARL17 antibody - middle region; anti-ARL17B antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human
Predicted Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD
Sequence Length
177
Applicable Applications for anti-ARL17B antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARL17
Protein Size (# AA)
177 amino acids
Blocking Peptide
For anti-ARL17B (MBS3212662) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ARL17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
WB (Western Blot)
(WB Suggested Anti-ARL17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-ARL17B antibody
This is a rabbit polyclonal antibody against ARL17. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Target Description: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Product Categories/Family for anti-ARL17B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 17 isoform a
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 17B
NCBI Official Symbol
ARL17B
NCBI Official Synonym Symbols
ARL17; ARL17A
NCBI Protein Information
ADP-ribosylation factor-like protein 17
UniProt Protein Name
ADP-ribosylation factor-like protein 17
UniProt Gene Name
ARL17A
UniProt Synonym Gene Names
ARL17P1
Similar Products
Product Notes
The ARL17B arl17a (Catalog #AAA200562) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL17 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL17 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ARL17B arl17a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCSHVEFGMW KGGRSHPFLP HSSRCAGSGG QLDSILPHQS PAWGPWGCKD. It is sometimes possible for the material contained within the vial of "ARL17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.