Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198959_WB10.jpg WB (Western Blot) (WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit anti-Human ARSE Polyclonal Antibody | anti-ARSE antibody

ARSE antibody - middle region

Gene Names
ARSE; ASE; CDPX; CDPX1; CDPXR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARSE, Antibody; ARSE antibody - middle region; anti-ARSE antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS
Sequence Length
589
Applicable Applications for anti-ARSE antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARSE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

product-image-AAA198959_WB10.jpg WB (Western Blot) (WB Suggested Anti-ARSE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: ARSESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198959_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: ARSESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-ARSE antibodyFormalin Fixed Paraffin Embedded Tissue: Human PancreasPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA198959_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ARSE antibodyFormalin Fixed Paraffin Embedded Tissue: Human PancreasPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-ARSE antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA198959_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ARSE antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-ARSE antibody
This is a rabbit polyclonal antibody against ARSE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-170 AC005295.1 87561-87730 c 171-744 AK223183.1 1-574 745-2036 AK223199.1 542-1833 2037-2220 AW779826.1 1-184 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
415
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
arylsulfatase E isoform 2
NCBI Official Synonym Full Names
arylsulfatase E
NCBI Official Symbol
ARSE
NCBI Official Synonym Symbols
ASE; CDPX; CDPX1; CDPXR
NCBI Protein Information
arylsulfatase E
UniProt Protein Name
Arylsulfatase E
UniProt Gene Name
ARSE
UniProt Synonym Gene Names
ASE
UniProt Entry Name
ARSE_HUMAN

Similar Products

Product Notes

The ARSE arse (Catalog #AAA198959) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARSE antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARSE can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ARSE arse for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVVHHDPPLL FDLSRDPSET HILTPASEPV FYQVMERVQQ AVWEHQRTLS. It is sometimes possible for the material contained within the vial of "ARSE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.