Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201511_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ASH2LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ASH2L Polyclonal Antibody | anti-ASH2L antibody

ASH2L Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ASH2L; ASH2; Bre2; ASH2L1; ASH2L2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ASH2L, Antibody; ASH2L Antibody - middle region; anti-ASH2L antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGP
Sequence Length
628
Applicable Applications for anti-ASH2L antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ASH2L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: ASH2LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201511_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ASH2LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ASH2LSample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201511_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ASH2LSample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-ASH2L antibody
This is a rabbit polyclonal antibody against ASH2L. It was validated on Western Blot

Target Description: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. ASH2L may function as a transcriptional regulator and may play a role in hematopoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
set1/Ash2 histone methyltransferase complex subunit ASH2 isoform b
NCBI Official Synonym Full Names
ASH2 like, histone lysine methyltransferase complex subunit
NCBI Official Symbol
ASH2L
NCBI Official Synonym Symbols
ASH2; Bre2; ASH2L1; ASH2L2
NCBI Protein Information
set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Protein Name
Set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Gene Name
ASH2L
UniProt Synonym Gene Names
ASH2L1
UniProt Entry Name
ASH2L_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ASH2L ash2l (Catalog #AAA201511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASH2L Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASH2L can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ASH2L ash2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTWPNNIVKT MSKERDVFLV KEHPDPGSKD PEEDYPKFGL LDQDLSNIGP. It is sometimes possible for the material contained within the vial of "ASH2L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.