Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200156_WB8.jpg WB (Western Blot) (WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ASPH is expressed in HepG2)

Rabbit ASPH Polyclonal Antibody | anti-ASPH antibody

ASPH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ASPH; AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ASPH, Antibody; ASPH antibody - N-terminal region; anti-ASPH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD
Sequence Length
225
Applicable Applications for anti-ASPH antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ASPH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ASPH is expressed in HepG2)

product-image-AAA200156_WB8.jpg WB (Western Blot) (WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ASPH is expressed in HepG2)

WB (Western Blot)

(WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

product-image-AAA200156_WB10.jpg WB (Western Blot) (WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

WB (Western Blot)

(WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

product-image-AAA200156_WB11.jpg WB (Western Blot) (WB Suggested Anti-ASPH Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlASPH is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200156_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlASPH is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: ASPHSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA200156_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ASPHSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ASPH antibody
This is a rabbit polyclonal antibody against ASPH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
Product Categories/Family for anti-ASPH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
444
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
aspartyl/asparaginyl beta-hydroxylase isoform e
NCBI Official Synonym Full Names
aspartate beta-hydroxylase
NCBI Official Symbol
ASPH
NCBI Official Synonym Symbols
AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
NCBI Protein Information
aspartyl/asparaginyl beta-hydroxylase
UniProt Protein Name
Aspartyl/asparaginyl beta-hydroxylase
UniProt Gene Name
ASPH
UniProt Synonym Gene Names
BAH; ASP beta-hydroxylase
UniProt Entry Name
ASPH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ASPH asph (Catalog #AAA200156) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASPH antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASPH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ASPH asph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAEDKETKHG GHKNGRKGGL SGTSFFTWFM VIALLGVWTS VAVVWFDLVD. It is sometimes possible for the material contained within the vial of "ASPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.