Rabbit Atat1 Polyclonal Antibody | anti-ATAT1 antibody
Atat1 Antibody - middle region
Gene Names
Atat1; TAT; Mec17; RGD1303066; 3110080J08Rik
Reactivity
Tested Species Reactivity: RatPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Atat1, Antibody; Atat1 Antibody - middle region; anti-ATAT1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Rat
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
Sequence Length
421
Applicable Applications for anti-ATAT1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Atat1
Protein Size (# AA)
421 amino acids
Enhanced Validation
WB
Y
SPR
YCHAROS
Y
SPR
YCHAROS
Blocking Peptide
For anti-Atat1 (MBS3206482) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ATAT1 antibody
This is a rabbit polyclonal antibody against Atat1. It was validated on Western Blot
Target Description: Atat1 specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development.
Target Description: Atat1 specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development.
Product Categories/Family for anti-ATAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
alpha-tubulin N-acetyltransferase 1
NCBI Official Synonym Full Names
alpha tubulin acetyltransferase 1
NCBI Official Symbol
Atat1
NCBI Official Synonym Symbols
TAT; Mec17; RGD1303066; 3110080J08Rik
NCBI Protein Information
alpha-tubulin N-acetyltransferase 1
UniProt Protein Name
Alpha-tubulin N-acetyltransferase 1
UniProt Gene Name
Atat1
UniProt Synonym Gene Names
Alpha-TAT; Alpha-TAT1; TAT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ATAT1 atat1 (Catalog #AAA199151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atat1 Antibody - middle region reacts with Tested Species Reactivity: Rat Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Atat1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATAT1 atat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WPLNRAPRRA TPPAHPPPRS SSLGNSPDRG PLRPFVPEQE LLRSLRLCPP. It is sometimes possible for the material contained within the vial of "Atat1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
