WB (Western Blot)
(Western blot analysis of extracts of C6, using ATF4 antibody at 1:500 dilution.C6 cells were treated by tunicamycin (2 ug/ml) for 8 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Rabbit anti-Mouse ATF4 Polyclonal Antibody | anti-ATF4 antibody
ATF4 Rabbit pAb
Gene Names
CEMIP2; TMEM2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
ATF4, Antibody; ATF4 Rabbit pAb; ATF4; CREB-2; CREB2; TAXREB67; TXREB; activating transcription factor 4; anti-ATF4 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ERVKIQAATDSKDISNCMAKAYPQYYRKPSVVKRMPAMLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGTDFTFRSAGVLLLVV
Applicable Applications for anti-ATF4 antibody
WB (Western Blot)
Positive Samples
C2C12, C6
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 260-351 of human ATF4 (NP_877962.1).
Cellular Location
Cell membrane, Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of extracts of C6, using ATF4 antibody at 1:500 dilution.C6 cells were treated by tunicamycin (2 ug/ml) for 8 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of extracts of C6, using ATF4 antibody at 1:500 dilution.C6 cells were treated by tunicamycin (2 ug/ml) for 8 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of extracts of C2C12, using ATF4 antibody at 1:500 dilution.C2C12 cells were treated by tunicamycin (2 ug/ml) for 8 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of C2C12, using ATF4 antibody at 1:500 dilution.C2C12 cells were treated by tunicamycin (2 ug/ml) for 8 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-ATF4 antibody
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication.
Product Categories/Family for anti-ATF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
147,439 Da
NCBI Official Full Name
cell surface hyaluronidase isoform b
NCBI Official Synonym Full Names
cell migration inducing hyaluronidase 2
NCBI Official Symbol
CEMIP2
NCBI Official Synonym Symbols
TMEM2
NCBI Protein Information
cell surface hyaluronidase
UniProt Protein Name
Cell surface hyaluronidase
UniProt Gene Name
TMEM2
Similar Products
Product Notes
The ATF4 tmem2 (Catalog #AAA282211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATF4 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ATF4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATF4 tmem2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ERVKIQAATD SKDISNCMAK AYPQYYRKPS VVKRMPAMLT GLCQGCGTRQ VVFTSDPHKS YLPVQFQSPD KAETQRGDPS VISVNGTDFT FRSAGVLLLV V. It is sometimes possible for the material contained within the vial of "ATF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.