Rabbit ATL2 Polyclonal Antibody | anti-ATL2 antibody
ATL2 Polyclonal Antibody
Gene Names
ATL2; aip-2; ARL3IP2; ARL6IP2; atlastin2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ATL2, Antibody; ATL2 Polyclonal Antibody; ATL2; ARL3IP2; ARL6IP2; aip-2; atlastin2; atlastin-2; anti-ATL2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Concentration
3.23 mg/ml (varies by lot)
Sequence Length
583
Applicable Applications for anti-ATL2 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human ATL2 (NP_001129145.1).
Immunogen Sequence
ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY
Positive Samples
U-87MG, HT-29, Jurkat, HeLa
Cellular Location
Endoplasmic Reticulum Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 46kDa; 64kDa; 65kDa; 66kDa
Observed: 66kDa
Observed: 66kDa
NCBI Official Full Name
atlastin-2 isoform 2
NCBI Official Synonym Full Names
atlastin GTPase 2
NCBI Official Symbol
ATL2
NCBI Official Synonym Symbols
aip-2; ARL3IP2; ARL6IP2; atlastin2
NCBI Protein Information
atlastin-2
UniProt Protein Name
Atlastin-2
UniProt Gene Name
ATL2
UniProt Synonym Gene Names
ARL6IP2; ARL-6-interacting protein 2; Aip-2
UniProt Entry Name
ATLA2_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ATL2 atl2 (Catalog #AAA281450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATL2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATL2 atl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
