WB (Western Blot)
(WB Suggested Anti-ATP2C1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateATP2C1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit ATP2C1 Polyclonal Antibody | anti-ATP2C1 antibody
ATP2C1 antibody - C-terminal region
Gene Names
ATP2C1; HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ATP2C1, Antibody; ATP2C1 antibody - C-terminal region; anti-ATP2C1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA
Sequence Length
888
Applicable Applications for anti-ATP2C1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ATP2C1
Protein Size (# AA)
888 amino acids
Protein Interactions
UBC; RNF2; ELAVL1;
Blocking Peptide
For anti-ATP2C1 (MBS3207350) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ATP2C1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateATP2C1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
WB (Western Blot)
(WB Suggested Anti-ATP2C1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateATP2C1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
IHC (Immunohistochemistry)
(Rabbit Anti-ATP2C1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in golgiPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-ATP2C1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in golgiPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ATP2C1 antibody
Target Description: ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-ATP2C1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
calcium-transporting ATPase type 2C member 1 isoform 1c
NCBI Official Synonym Full Names
ATPase secretory pathway Ca2+ transporting 1
NCBI Official Symbol
ATP2C1
NCBI Official Synonym Symbols
HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
NCBI Protein Information
calcium-transporting ATPase type 2C member 1
UniProt Protein Name
Calcium-transporting ATPase type 2C member 1
UniProt Gene Name
ATP2C1
UniProt Synonym Gene Names
KIAA1347; PMR1L; ATPase 2C1
UniProt Entry Name
AT2C1_HUMAN
Similar Products
Product Notes
The ATP2C1 atp2c1 (Catalog #AAA199437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP2C1 antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2C1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP2C1 atp2c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKSVFEIGLC SNRMFCYAVL GSIMGQLLVI YFPPLQKVFQ TESLSILGLA. It is sometimes possible for the material contained within the vial of "ATP2C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.