Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199886_WB13.jpg WB (Western Blot) (Sample Type: Human HepG2ATP5B antibody - C-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.)

Rabbit ATP5F1B Polyclonal Antibody | anti-ATP5F1B antibody

ATP5F1B Antibody - C-terminal region

Gene Names
ATP5F1B; ATP5B; ATPMB; ATPSB; HEL-S-271
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Protein A purified
Synonyms
ATP5F1B, Antibody; ATP5F1B Antibody - C-terminal region; anti-ATP5F1B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
Sequence Length
529
Applicable Applications for anti-ATP5F1B antibody
WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ATP5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Sample Type: Human HepG2ATP5B antibody - C-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.)

product-image-AAA199886_WB13.jpg WB (Western Blot) (Sample Type: Human HepG2ATP5B antibody - C-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: Human BrainTitration:2 ug/mlPositive Control:Human brain stem cells)

product-image-AAA199886_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human BrainTitration:2 ug/mlPositive Control:Human brain stem cells)
Related Product Information for anti-ATP5F1B antibody
This is a rabbit polyclonal antibody against ATP5B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
506
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
ATP synthase subunit beta, mitochondrial
NCBI Official Synonym Full Names
ATP synthase F1 subunit beta
NCBI Official Symbol
ATP5F1B
NCBI Official Synonym Symbols
ATP5B; ATPMB; ATPSB; HEL-S-271
NCBI Protein Information
ATP synthase subunit beta, mitochondrial
UniProt Protein Name
ATP synthase subunit beta, mitochondrial
UniProt Gene Name
ATP5B
UniProt Synonym Gene Names
ATPMB; ATPSB

Similar Products

Product Notes

The ATP5F1B atp5b (Catalog #AAA199886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5F1B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5F1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ATP5F1B atp5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGKLVPLKET IKGFQQILAG EYDHLPEQAF YMVGPIEEAV AKADKLAEEH. It is sometimes possible for the material contained within the vial of "ATP5F1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.