WB (Western Blot)
(WB Suggested Anti-ATP5H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateATP5H is supported by BioGPS gene expression data to be expressed in MCF7)
Rabbit ATP5PD Polyclonal Antibody | anti-ATP5PD antibody
ATP5PD Antibody - C-terminal region
Gene Names
ATP5PD; ATPQ; APT5H; ATP5H
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP5PD, Antibody; ATP5PD Antibody - C-terminal region; anti-ATP5PD antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY
Sequence Length
161
Applicable Applications for anti-ATP5PD antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Sheep: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ATP5H
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ATP5H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateATP5H is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(WB Suggested Anti-ATP5H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateATP5H is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: ATP5HSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ATP5HSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ATP5HSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ATP5HSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATP5PD antibody
This is a rabbit polyclonal antibody against ATP5H. It was validated on Western Blot
Target Description: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15.
Target Description: Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15.
Product Categories/Family for anti-ATP5PD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
ATP synthase subunit d, mitochondrial isoform a
NCBI Official Synonym Full Names
ATP synthase peripheral stalk subunit d
NCBI Official Symbol
ATP5PD
NCBI Official Synonym Symbols
ATPQ; APT5H; ATP5H
NCBI Protein Information
ATP synthase subunit d, mitochondrial
UniProt Protein Name
ATP synthase subunit d, mitochondrial
UniProt Gene Name
ATP5H
UniProt Synonym Gene Names
ATPase subunit d
UniProt Entry Name
ATP5H_HUMAN
Similar Products
Product Notes
The ATP5PD atp5h (Catalog #AAA200216) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5PD Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5PD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATP5PD atp5h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CAEWVSLSKA RIVEYEKEME KMKNLIPFDQ MTIEDLNEAF PETKLDKKKY. It is sometimes possible for the material contained within the vial of "ATP5PD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.