Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46386_IHC10.jpg IHC (Immunohistochemistry) (Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Human Mammary Cancer Tissue)

ATX2 Polyclonal Antibody | anti-ATX2 antibody

Anti-ATX2 Antibody

Average rating 0.0
No ratings yet
Gene Names
ATXN2; ATX2; SCA2; ASL13; TNRC13
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ATX2, Antibody; Anti-ATX2 Antibody; Ataxin-2; Ataxin 2; ATXN2; Olivopontocerebellar ataxia 2, autosomal dominant; SCA2; Spinocerebellar ataxia type 2 protein; TNRC13; Trinucleotide repeat containing gene 13 protein antibody; ataxin 2; anti-ATX2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1006
Applicable Applications for anti-ATX2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46386_IHC10.jpg IHC (Immunohistochemistry) (Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46386_IHC11.jpg IHC (Immunohistochemisry) (Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46386_IHC13.jpg IHC (Immunohiostchemistry) (Anti- ATX2 Picoband antibody, AAA46386, IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- ATX2 Picoband antibody, AAA46386, Western blottingAll lanes: Anti ATX2 (AAA46386) at 0.5ug/mlWB: Mouse Liver Tissue Lysate at 50ugPredicted bind size: 140KDObserved bind size: 140KD)

product-image-AAA46386_WB15.jpg WB (Western Blot) (Anti- ATX2 Picoband antibody, AAA46386, Western blottingAll lanes: Anti ATX2 (AAA46386) at 0.5ug/mlWB: Mouse Liver Tissue Lysate at 50ugPredicted bind size: 140KDObserved bind size: 140KD)
Related Product Information for anti-ATX2 antibody
Description: Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.
References
1. Pulst, S.-M., Nechiporuk, A., Nechiporuk, T., Gispert, S., Chen, X.-N., Lopes-Cendes, I., Pearlman, S., Starkman, S., Orozco-Diaz, G., Lunkes, A., DeJong, P., Rouleau, G. A., Auburger, G., Korenberg, J. R., Figueroa, C., Sahba, S. Moderate expansion of a normally biallelic trinucleotide repeat in spinocerebellar ataxia type 2. 2. Ralser, M., Nonhoff, U., Albrecht, M., Lengauer, T., Wanker, E. E., Lehrach, H., Krobitsch, S. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Molec. Genet. 14: 2893-2909, 2005.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,037 Da
NCBI Official Full Name
ataxin-2 isoform 3
NCBI Official Synonym Full Names
ataxin 2
NCBI Official Symbol
ATXN2
NCBI Official Synonym Symbols
ATX2; SCA2; ASL13; TNRC13
NCBI Protein Information
ataxin-2
UniProt Protein Name
Ataxin-2
UniProt Gene Name
ATXN2
UniProt Synonym Gene Names
ATX2; SCA2; TNRC13
UniProt Entry Name
ATX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ATX2 atxn2 (Catalog #AAA46386) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATX2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATX2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATX2 atxn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.