WB (Western Blot)
(Host: RabbitTarget Name: ATXN1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human ATXN1 Polyclonal Antibody | anti-ATXN1 antibody
ATXN1 Antibody - N-terminal region
Gene Names
ATXN1; ATX1; SCA1; D6S504E
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATXN1, Antibody; ATXN1 Antibody - N-terminal region; anti-ATXN1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5- 1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TAWLPGNPGGRGHGGGRHGPAGTSVELGLQQGIGLHKALSTGLDYSPPSA
Sequence Length
815
Applicable Applications for anti-ATXN1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATXN1.
Protein Size
815 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: ATXN1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ATXN1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATXN1 antibody
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-ATXN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87 kDa
NCBI Official Full Name
ataxin-1 ATXN1
NCBI Official Synonym Full Names
ataxin 1
NCBI Official Symbol
ATXN1
NCBI Official Synonym Symbols
ATX1; SCA1; D6S504E
NCBI Protein Information
ataxin-1
UniProt Protein Name
Ataxin-1
UniProt Gene Name
ATXN1
UniProt Synonym Gene Names
ATX1; SCA1
UniProt Entry Name
ATX1_HUMAN
Similar Products
Product Notes
The ATXN1 atxn1 (Catalog #AAA201590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATXN1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATXN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATXN1 atxn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAWLPGNPGG RGHGGGRHGP AGTSVELGLQ QGIGLHKALS TGLDYSPPSA. It is sometimes possible for the material contained within the vial of "ATXN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.