Rabbit AUNIP Polyclonal Antibody | anti-AUNIP antibody
AUNIP Antibody - N-terminal region
Gene Names
AUNIP; AIBP; C1orf135
Reactivity
HumanPredicted: Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AUNIP, Antibody; AUNIP Antibody - N-terminal region; anti-AUNIP antibody
Host
Rabbit
Reactivity
Human
Predicted: Cow, Dog, Horse, Human, Pig, Rabbit
Predicted: Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RAPSTGIHQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQL
Sequence Length
357
Applicable Applications for anti-AUNIP antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AUNIP
Protein Size
357 amino acids
Protein Interactions
PRMT6; ELAVL1
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-AUNIP antibody
This is a rabbit polyclonal antibody against AUNIP. It was validated on Western Blot
Target Description: AUNIP is required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle.
Target Description: AUNIP is required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle.
Product Categories/Family for anti-AUNIP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
aurora kinase A and ninein-interacting protein isoform 2
NCBI Official Synonym Full Names
aurora kinase A and ninein interacting protein
NCBI Official Symbol
AUNIP
NCBI Official Synonym Symbols
AIBP; C1orf135
NCBI Protein Information
aurora kinase A and ninein-interacting protein
UniProt Protein Name
Aurora kinase A and ninein-interacting protein
UniProt Gene Name
AUNIP
UniProt Synonym Gene Names
C1orf135; AIBp
UniProt Entry Name
AUNIP_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The AUNIP aunip (Catalog #AAA201423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AUNIP Antibody - N-terminal region reacts with Human Predicted: Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's AUNIP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AUNIP aunip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RAPSTGIHQR SIASFFTLQP GKTNGSDQKS VSSHTESQIN KESKKNATQL. It is sometimes possible for the material contained within the vial of "AUNIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
