Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

awd Polyclonal Antibody | anti-awd antibody

Rabbit anti-Drosophila melanogaster (Fruit fly) awd Polyclonal Antibody

Gene Names
awd; 1084/08; anon-EST:Liang-2.27; anon-EST:Liang-2.28; anon-WO0172774.80; anon-WO0172774.82; Awd; BcDNA:GM19775; BcDNA:RH27794; CG2210; clone 2.27; clone 2.28; DmelCG2210; e(shi)A; eshiA; K-pn; Kpn; l(3)j2A4; l(3)L8700; NDKB; NDPK; Nm23; Nm23/awd
Applications
Western Blot, ELISA
Purity
Antibody purity > 90% confirmed by SDS-PAGE
Synonyms
awd, Antibody; Rabbit anti-Drosophila melanogaster (Fruit fly) awd Polyclonal Antibody; awd Antibody; Nucleoside diphosphate kinase; NDK; NDP kinase; EC 2.7.4.6; Abnormal wing disks protein; Killer of prune protein; awd K-pn CG2210; anti-awd antibody
Ordering
Host
Escherichia coli (E. coli)
Clonality
Polyclonal
Purity/Purification
Antibody purity > 90% confirmed by SDS-PAGE
Sequence
AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGL NVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE
Applicable Applications for anti-awd antibody
WB (Western Blot), ELISA
Antigen
Recombinant Drosophila melanogaster (Fruit fly) awd protein
Target Name
awd
Species
Drosophila melanogaster (Fruit fly)
AA Range
2-153aa

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,170 Da
NCBI Official Full Name
abnormal wing discs, isoform E
NCBI Official Synonym Full Names
abnormal wing discs
NCBI Official Symbol
awd
NCBI Official Synonym Symbols
1084/08; anon-EST:Liang-2.27; anon-EST:Liang-2.28; anon-WO0172774.80; anon-WO0172774.82; Awd; BcDNA:GM19775; BcDNA:RH27794; CG2210; clone 2.27; clone 2.28; DmelCG2210; e(shi)A; eshiA; K-pn; Kpn; l(3)j2A4; l(3)L8700; NDKB; NDPK; Nm23; Nm23/awd
NCBI Protein Information
CG2210 gene product from transcript CG2210-RD
UniProt Protein Name
Nucleoside diphosphate kinase
UniProt Gene Name
awd
UniProt Synonym Gene Names
K-pn; NDK; NDP kinase

Similar Products

Product Notes

The awd awd (Catalog #AAA244135) is an Antibody produced from Escherichia coli (E. coli) and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's awd can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the awd awd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AANKERTFIM VKPDGVQRGL VGKIIERFEQ KGFKLVALKF TWASKELLEK HYADLSARPF FPGLVNYMNS GPVVPMVWEG L NVVKTGRQ MLGATNPADS LPGTIRGDFC IQVGRNIIHG SDAVESAEKE IALWFNEKEL VTWTPAAKDW IYE. It is sometimes possible for the material contained within the vial of "awd, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.