Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282393_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of SW620 cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human AXIN2 Polyclonal Antibody | anti-AXIN2 antibody

AXIN2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
AXIN2; AXIL; ODCRCS
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
AXIN2, Antibody; AXIN2 Rabbit pAb; AXIL; ODCRCS; anti-AXIN2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
ACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGN
Applicable Applications for anti-AXIN2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Cellular Location
Cytoplasm
Research Area
Epigenetics Nuclear Signaling, Cancer, Cell Biology Developmental Biology, Cell Cycle, Centrosome, Cell differentiation, Wnt ---Catenin Signaling Pathway, ESC Pluripotency and Differentiation, Neuroscience, Stem Cells
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human AXIN2 (NP_004646.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of SW620 cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282393_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of SW620 cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282393_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of 293T cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282393_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T cells using AXIN2 Rabbit pAb (AAA282393) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-AXIN2 antibody
The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair.
Product Categories/Family for anti-AXIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,558 Da
NCBI Official Full Name
axin-2
NCBI Official Synonym Full Names
axin 2
NCBI Official Symbol
AXIN2
NCBI Official Synonym Symbols
AXIL; ODCRCS
NCBI Protein Information
axin-2; conductin; axin-like protein; axis inhibition protein 2
UniProt Protein Name
Axin-2
UniProt Gene Name
AXIN2
UniProt Synonym Gene Names
Axil
UniProt Entry Name
AXIN2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AXIN2 axin2 (Catalog #AAA282393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AXIN2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AXIN2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the AXIN2 axin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ACRRLAEVSK PPKQRCCVAS QQRDRNHSAT VQTGATPFSN PSLAPEDHKE PKKLAGVHAL QASELVVTYF FCGEEIPYRR MLKAQSLTLG HFKEQLSKKG N. It is sometimes possible for the material contained within the vial of "AXIN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.