Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199566_WB11.jpg WB (Western Blot) (WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Brain)

Rabbit B3galt2 Polyclonal Antibody | anti-B3GALT2 antibody

B3galt2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
B3galt2, Antibody; B3galt2 antibody - C-terminal region; anti-B3GALT2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
Sequence Length
422
Applicable Applications for anti-B3GALT2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Brain)

product-image-AAA199566_WB11.jpg WB (Western Blot) (WB Suggested Anti-B3galt2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Brain)

WB (Western Blot)

(Host: RabbitTarget Name: B3GALT2Sample Tissue: Mouse NIH 373 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199566_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: B3GALT2Sample Tissue: Mouse NIH 373 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: B3Galt2 Cyan: Nissl(Neurons)Gene Name :B3galt2Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University)

product-image-AAA199566_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: B3Galt2 Cyan: Nissl(Neurons)Gene Name :B3galt2Submitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University)
Related Product Information for anti-B3GALT2 antibody
This is a rabbit polyclonal antibody against B3galt2. It was validated on Western Blot

Target Description: B3galt2 is beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. B3galt2 can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. B3galt2 is involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.
Product Categories/Family for anti-B3GALT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
beta-1,3-galactosyltransferase 2
NCBI Official Synonym Full Names
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
NCBI Official Symbol
B3galt2
NCBI Protein Information
beta-1,3-galactosyltransferase 2
UniProt Protein Name
Beta-1,3-galactosyltransferase 2
UniProt Gene Name
B3galt2
UniProt Synonym Gene Names
Beta-1,3-GalTase 2; Beta3Gal-T2; Beta3GalT2
UniProt Entry Name
B3GT2_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The B3GALT2 b3galt2 (Catalog #AAA199566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B3galt2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's B3galt2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the B3GALT2 b3galt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVDPVPPPNE FVFNHWRVSY SSCKYSHLIT SHQFQPSELI KYWNHLQQNK. It is sometimes possible for the material contained within the vial of "B3galt2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.