Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200547_WB10.jpg WB (Western Blot) (WB Suggested Anti-BCKDHA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateBCKDHA is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit BCKDHA Polyclonal Antibody | anti-BCKDHA antibody

BCKDHA antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
BCKDHA; MSU; MSUD1; OVD1A; BCKDE1A
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
BCKDHA, Antibody; BCKDHA antibody - N-terminal region; anti-BCKDHA antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
Sequence Length
445
Applicable Applications for anti-BCKDHA antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA
Protein size (#AA)
445 amino acids
Blocking Peptide
For anti-BCKDHA (MBS3212571) antibody is Catalog #
Protein Interactions
UBC; CUL3; BCKDHB; BCKDK;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BCKDHA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateBCKDHA is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA200547_WB10.jpg WB (Western Blot) (WB Suggested Anti-BCKDHA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateBCKDHA is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200547_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: BCKDHASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200547_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: BCKDHASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-BCKDHA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200547_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-BCKDHA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I & II cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-BCKDHA antibody
This is a rabbit polyclonal antibody against BCKDHA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).The BCKDHA gene encodes the E1-alpha subunit of the branched-chain alpha-keto acid (BCAA) dehydrogenase complex (BCKD; EC 1.2.4.4), an inner-mitochondrial enzyme complex that catalyzes the oxidative decarboxylation of the branched-chain alpha-ketoacids derived from isoleucine, leucine, and valine. This reaction is the second major step in the catabolism of the branched-chain amino acids (Wynn et al., 1998 [PubMed 9582350]). The BCKD complex consists of 3 catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a homo-24-meric dihydrolipoyl transacylase (E2; MIM 248610), and a homodimeric dihydrolipoamide dehydrogenase (E3; MIM 238331). E1 is a thiamine pyrophosphate (TPP)-dependent enzyme. The reaction is irreversible and constitutes the first committed step in BCAA oxidation. The BCKDHB gene (MIM 248611) encodes the beta subunit of E1. The complex also contains 2 regulatory enzymes, a kinase and a phosphorylase.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-675 BI910860.1 12-686 676-1196 BG742673.1 80-600 1197-1731 BM702667.1 48-582 1732-1763 BE223026.1 1-32 c 1764-1781 BQ018849.1 1-18 c
Product Categories/Family for anti-BCKDHA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
593
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial isoform 1
NCBI Official Synonym Full Names
branched chain keto acid dehydrogenase E1, alpha polypeptide
NCBI Official Symbol
BCKDHA
NCBI Official Synonym Symbols
MSU; MSUD1; OVD1A; BCKDE1A
NCBI Protein Information
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
UniProt Protein Name
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
UniProt Gene Name
BCKDHA
UniProt Synonym Gene Names
BCKDE1A; BCKDH E1-alpha
UniProt Entry Name
ODBA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCKDHA bckdha (Catalog #AAA200547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCKDHA antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BCKDHA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BCKDHA bckdha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVISGIPIYR VMDRQGQIIN PSEDPHLPKE KVLKLYKSMT LLNTMDRILY. It is sometimes possible for the material contained within the vial of "BCKDHA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.