Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201264_WB13.jpg WB (Western Blot) (WB Suggested Anti-BCMO1 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit anti-Human BCO1 Polyclonal Antibody | anti-BCO1 antibody

BCO1 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
BCO1; BCO; BCDO; BCMO; BCDO1; BCMO1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCO1, Antibody; BCO1 Antibody - middle region; anti-BCO1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHS
Sequence Length
547
Applicable Applications for anti-BCO1 antibody
WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BCMO1 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

product-image-AAA201264_WB13.jpg WB (Western Blot) (WB Suggested Anti-BCMO1 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: BCMO1Sample Type: 293TAntibody Dilution: 1.0ug/mlBCMO1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA201264_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: BCMO1Sample Type: 293TAntibody Dilution: 1.0ug/mlBCMO1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-BCO1 antibody
This is a rabbit polyclonal antibody against BCMO1. It was validated on Western Blot

Target Description: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.
Product Categories/Family for anti-BCO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
beta,beta-carotene 15,15'-dioxygenase
NCBI Official Synonym Full Names
beta-carotene oxygenase 1
NCBI Official Symbol
BCO1
NCBI Official Synonym Symbols
BCO; BCDO; BCMO; BCDO1; BCMO1
NCBI Protein Information
beta,beta-carotene 15,15'-dioxygenase
UniProt Protein Name
Beta,beta-carotene 15,15'-monooxygenase
UniProt Gene Name
BCMO1
UniProt Synonym Gene Names
BCDO; BCDO1
UniProt Entry Name
BCDO1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCO1 bcmo1 (Catalog #AAA201264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCO1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BCO1 bcmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEKGKTKYVI FKIPATVPEG KKQGKSPWKH TEVFCSIPSR SLLSPSYYHS. It is sometimes possible for the material contained within the vial of "BCO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.