Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA108388_IHC13.jpg IHC (Immunohiostchemistry) (Small intestine, myenteric plexus)

Rabbit Beta Tubulin 2A Polyclonal Antibody

Beta Tubulin 2A antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat, Arabidopsis, Drosophila
Applications
Western Blot
Purity
Affinity purified
Synonyms
Beta Tubulin 2A, Antibody; Beta Tubulin 2A antibody; Polyclonal Beta Tubulin 2A; Anti-Beta Tubulin 2A; TUBB; TUBB2; dJ40E16.7; TUBB2A; anti-Beta Tubulin 2A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Arabidopsis, Drosophila
Clonality
Polyclonal
Specificity
Beta Tubulin 2A antibody was raised against the middle region of TUBB2A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBB2A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-Beta Tubulin 2A antibody
WB (Western Blot)
Biological Significance
TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Cross-Reactivity
Human,Mouse,Rat,Arabidopsis,Drosophila
Immunogen
Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Small intestine, myenteric plexus)

product-image-AAA108388_IHC13.jpg IHC (Immunohiostchemistry) (Small intestine, myenteric plexus)

WB (Western Blot)

product-image-AAA108388_WB15.jpg WB (Western Blot)
Related Product Information for anti-Beta Tubulin 2A antibody
Rabbit polyclonal Beta Tubulin 2A antibody raised against the middle region of TUBB2A
Product Categories/Family for anti-Beta Tubulin 2A antibody

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Beta Tubulin 2A (Catalog #AAA108388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Beta Tubulin 2A antibody reacts with Human, Mouse, Rat, Arabidopsis, Drosophila and may cross-react with other species as described in the data sheet. AAA Biotech's Beta Tubulin 2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Beta Tubulin 2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Beta Tubulin 2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.