Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201310_WB15.jpg WB (Western Blot) (WB Suggested Anti-BFSP2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit BFSP2 Polyclonal Antibody | anti-BFSP2 antibody

BFSP2 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
BFSP2; CP47; CP49; LIFL-L; CTRCT12; PHAKOSIN
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BFSP2, Antibody; BFSP2 Antibody - middle region; anti-BFSP2 antibody
Ordering
Host
Rabbit
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: CQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLY
Sequence Length
415
Applicable Applications for anti-BFSP2 antibody
WB (Western Blot)
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human BFSP2
Protein Size
415 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BFSP2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

product-image-AAA201310_WB15.jpg WB (Western Blot) (WB Suggested Anti-BFSP2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-BFSP2 antibody
This is a rabbit polyclonal antibody against BFSP2. It was validated on Western Blot

Target Description: More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and Dowling-Meara epidermolysis bullosa simplex.
Product Categories/Family for anti-BFSP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
phakinin
NCBI Official Synonym Full Names
beaded filament structural protein 2
NCBI Official Symbol
BFSP2
NCBI Official Synonym Symbols
CP47; CP49; LIFL-L; CTRCT12; PHAKOSIN
NCBI Protein Information
phakinin
UniProt Protein Name
Phakinin
UniProt Gene Name
BFSP2
UniProt Entry Name
BFSP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BFSP2 bfsp2 (Catalog #AAA201310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BFSP2 Antibody - middle region reacts with Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish Tested: Human and may cross-react with other species as described in the data sheet. AAA Biotech's BFSP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BFSP2 bfsp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CQQVGEAVLE NARLMLQTET IQAGADDFKE RYENEQPFRK AAEEEINSLY. It is sometimes possible for the material contained within the vial of "BFSP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.