Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46554_FACS8.bmp FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of U20S cells using anti-BMP5 antibody (AAA46554).Overlay histogram showing U20S cells stained with AAA46554 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-BMP5 Antibody (AAA46554,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

BMP5 Polyclonal Antibody | anti-BMP5 antibody

Anti-BMP5 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
BMP5, Antibody; Anti-BMP5 Antibody; Bone morphogenetic protein 5; BMP 5; BMP-5; Bmp5; BMP5_HUMAN; MGC34244; bone morphogenetic protein 5; anti-BMP5 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
454
Applicable Applications for anti-BMP5 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of U20S cells using anti-BMP5 antibody (AAA46554).Overlay histogram showing U20S cells stained with AAA46554 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-BMP5 Antibody (AAA46554,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46554_FACS8.bmp FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of U20S cells using anti-BMP5 antibody (AAA46554).Overlay histogram showing U20S cells stained with AAA46554 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-BMP5 Antibody (AAA46554,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistochemistry)

(Anti- BMP5 Picoband antibody, AAA46554, IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46554_IHC10.bmp IHC (Immunohistochemistry) (Anti- BMP5 Picoband antibody, AAA46554, IHC(P)IHC(P): Human Lung Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- BMP5 Picoband antibody, AAA46554, IHC(P)IHC(P): Rat Lung Tissue)

product-image-AAA46554_IHC11.bmp IHC (Immunohistochemisry) (Anti- BMP5 Picoband antibody, AAA46554, IHC(P)IHC(P): Rat Lung Tissue)

IHC (Immunohiostchemistry)

(Anti- BMP-5 Picoband antibody, AAA46554, IHC(P)IHC(P): Mouse Liver Tissue)

product-image-AAA46554_IHC13.bmp IHC (Immunohiostchemistry) (Anti- BMP-5 Picoband antibody, AAA46554, IHC(P)IHC(P): Mouse Liver Tissue)

WB (Western Blot)

(Anti- BMP-5 Picoband antibody, AAA46554, Western blottingAll lanes: Anti BMP-5 (AAA46554) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 51KDObserved bind size: 51KD)

product-image-AAA46554_WB15.bmp WB (Western Blot) (Anti- BMP-5 Picoband antibody, AAA46554, Western blottingAll lanes: Anti BMP-5 (AAA46554) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 51KDObserved bind size: 51KD)
Related Product Information for anti-BMP5 antibody
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human;Mouse;Rat.

Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
References
1. "Entrez Gene: BMP5 bone morphogenetic protein 5". 2. Beck HN, Drahushuk K, Jacoby DB, Higgins D, Lein PJ (Mar 2003). "Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons". BMC Neurosci 2: 12. 3. Hahn GV, Cohen RB, Wozney JM, Levitz CL, Shore EM, Zasloff MA, Kaplan FS (Dec 1992). "A bone morphogenetic protein subfamily: chromosomal localization of human genes for BMP5, BMP6, and BMP7". Genomics 14 (3): 759-62.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
653
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,670 Da
NCBI Official Full Name
bone morphogenetic protein 5 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 5
NCBI Official Symbol
BMP5
NCBI Protein Information
bone morphogenetic protein 5
UniProt Protein Name
Bone morphogenetic protein 5
UniProt Gene Name
BMP5
UniProt Synonym Gene Names
BMP-5
UniProt Entry Name
BMP5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BMP5 bmp5 (Catalog #AAA46554) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-BMP5 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BMP5 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BMP5 bmp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.