Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282313_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit BMPR1B Polyclonal Antibody | anti-BMPR1B antibody

BMPR1B Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PAK2; PAK65; PAKgamma
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
BMPR1B, Antibody; BMPR1B Rabbit pAb; BMPR1B; ALK-6; ALK6; AMDD; BDA1D; BDA2; CDw293; bone morphogenetic protein receptor type-1B; anti-BMPR1B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVD
Applicable Applications for anti-BMPR1B antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-532 of human BMPR1B (NP_001243722.1).
Cellular Location
Membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282313_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282313_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282313_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using [KO Validated] BMPR1B Rabbit pAb at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-BMPR1B antibody
This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. Several transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,043 Da
NCBI Official Full Name
serine/threonine-protein kinase PAK 2
NCBI Official Synonym Full Names
p21 protein (Cdc42/Rac)-activated kinase 2
NCBI Official Symbol
PAK2
NCBI Official Synonym Symbols
PAK65; PAKgamma
NCBI Protein Information
serine/threonine-protein kinase PAK 2; p58; PAK-2; gamma-PAK; S6/H4 kinase; p21-activated kinase 2; p21 (CDKN1A)-activated kinase 2
UniProt Protein Name
Serine/threonine-protein kinase PAK 2
UniProt Gene Name
PAK2
UniProt Synonym Gene Names
PAK-2; p27; p34
UniProt Entry Name
PAK2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BMPR1B pak2 (Catalog #AAA282313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMPR1B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BMPR1B can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the BMPR1B pak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDNGELEDK PPAPPVRMSS TIFSTGGKDP LSANHSLKPL PSVPEEKKPR HKIISIFSGT EKGSKKKEKE RPEISPPSDF EHTIHVGFDA VTGEFTGMPE QWARLLQTSN ITKLEQKKNP QAVLDVLKFY DSNTVKQKYL SFTPPEKDGF PSGTPALNAK GTEAPAVVTE EEDDDEETAP PVIAPRPDHT KSIYTRSVID PVPAPVGDSH VD. It is sometimes possible for the material contained within the vial of "BMPR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.