Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162264_IHC13.jpg IHC (Immunohiostchemistry) (Anti-Brain Natriuretic Peptide 32 antibody IHC of human brain cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

Rabbit anti-Human Brain Natriuretic Peptide 32 Polyclonal Antibody

Anti-Brain Natriuretic Peptide 32 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Immunohistochemistry, ELISA, Dot Blot
Purity
Protein G purified
Synonyms
Brain Natriuretic Peptide 32, Antibody; Anti-Brain Natriuretic Peptide 32 Antibody; Rabbit Polyclonal (IgG) to Human Brain Natriuretic Peptide 32; anti-Brain Natriuretic Peptide 32 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Protein G purified
Form/Format
Lyophilized from PBS. No preservative added
Applicable Applications for anti-Brain Natriuretic Peptide 32 antibody
IHC (Immunohistochemistry), ELISA, DB (Dot Blot)
Immunogen
Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH
Conjugation
Unconjugated
Resuspension Liquid
Reconstitute at 1 mg/ml in PBS

IHC (Immunohiostchemistry)

(Anti-Brain Natriuretic Peptide 32 antibody IHC of human brain cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA162264_IHC13.jpg IHC (Immunohiostchemistry) (Anti-Brain Natriuretic Peptide 32 antibody IHC of human brain cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

IHC (Immunohistochemistry)

(Anti-Brain Natriuretic Peptide 32 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA162264_IHC15.jpg IHC (Immunohistochemistry) (Anti-Brain Natriuretic Peptide 32 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Brain Natriuretic Peptide 32 (Catalog #AAA162264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Brain Natriuretic Peptide 32 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Brain Natriuretic Peptide 32 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ELISA, DB (Dot Blot). Researchers should empirically determine the suitability of the Brain Natriuretic Peptide 32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Brain Natriuretic Peptide 32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.