Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198431_WB11.jpg WB (Western Blot) (WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateBRD7 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit BRD7 Polyclonal Antibody | anti-BRD7 antibody

BRD7 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
BRD7; BP75; NAG4; CELTIX1
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
BRD7, Antibody; BRD7 antibody - C-terminal region; anti-BRD7 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
Sequence Length
651
Applicable Applications for anti-BRD7 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateBRD7 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198431_WB11.jpg WB (Western Blot) (WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateBRD7 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: BRD7Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198431_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: BRD7Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-BRD7 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198431_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-BRD7 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-BRD7 antibody
This is a rabbit polyclonal antibody against BRD7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
Bromodomain-containing protein 7
NCBI Official Synonym Full Names
bromodomain containing 7
NCBI Official Symbol
BRD7
NCBI Official Synonym Symbols
BP75; NAG4; CELTIX1
NCBI Protein Information
bromodomain-containing protein 7
UniProt Protein Name
Bromodomain-containing protein 7
UniProt Gene Name
BRD7
UniProt Synonym Gene Names
BP75; CELTIX1
UniProt Entry Name
BRD7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BRD7 brd7 (Catalog #AAA198431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRD7 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BRD7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BRD7 brd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KELAQQVTPG DIVSTYGVRK AMGISIPSPV MENNFVDLTE DTEEPKKTDV. It is sometimes possible for the material contained within the vial of "BRD7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.