Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201473_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: C17orf99Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit C17orf99 Polyclonal Antibody | anti-C17ORF99 antibody

C17orf99 Antibody - N-terminal region

Gene Names
C17orf99; IL-40; UNQ464
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Dog
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C17orf99, Antibody; C17orf99 Antibody - N-terminal region; anti-C17ORF99 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Dog
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
TYSLCGTKNIKVAKKVVKTHEPASFNLNVTLKSSPDLLTYFCWASSTSGA
Applicable Applications for anti-C17ORF99 antibody
WB (Western Blot)
Protein Size (# AA)
265 amino acids
Blocking Peptide
For anti-C17orf99 (MBS3219067) antibody is Catalog # MBS3243961
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf99
Predicted Homology
Dog: 85%; Human: 100%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: C17orf99Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201473_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: C17orf99Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-C17ORF99 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-C17ORF99 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
protein IL-40
NCBI Official Synonym Full Names
chromosome 17 open reading frame 99
NCBI Official Symbol
C17orf99
NCBI Official Synonym Symbols
IL-40; UNQ464
NCBI Protein Information
protein IL-40; uncharacterized protein C17orf99
UniProt Protein Name
Uncharacterized protein C17orf99
UniProt Gene Name
C17orf99
UniProt Synonym Gene Names
UNQ464/PRO809
UniProt Entry Name
CQ099_HUMAN

Similar Products

Product Notes

The C17ORF99 c17orf99 (Catalog #AAA201473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C17orf99 Antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's C17orf99 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the C17ORF99 c17orf99 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TYSLCGTKNI KVAKKVVKTH EPASFNLNVT LKSSPDLLTY FCWASSTSGA. It is sometimes possible for the material contained within the vial of "C17orf99, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.