WB (Western Blot)
(WB Suggested Anti-C19orf28 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit anti-Human C19orf28 Polyclonal Antibody | anti-MFSD12 antibody
C19orf28 antibody - middle region
Gene Names
MFSD12; PP3501; C19orf28
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
C19orf28, Antibody; C19orf28 antibody - middle region; anti-MFSD12 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
Sequence Length
473
Applicable Applications for anti-MFSD12 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C19orf28
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-C19orf28 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-C19orf28 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-MFSD12 antibody
This is a rabbit polyclonal antibody against C19orf28. It was validated on Western Blot and immunohistochemistry
Target Description: The function remains known.
Target Description: The function remains known.
Product Categories/Family for anti-MFSD12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Synonym Full Names
major facilitator superfamily domain containing 12
NCBI Official Symbol
MFSD12
NCBI Official Synonym Symbols
PP3501; C19orf28
NCBI Protein Information
major facilitator superfamily domain-containing protein 12
UniProt Protein Name
Major facilitator superfamily domain-containing protein 12
UniProt Gene Name
MFSD12
UniProt Synonym Gene Names
C19orf28
UniProt Entry Name
MFS12_HUMAN
Similar Products
Product Notes
The MFSD12 mfsd12 (Catalog #AAA199504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C19orf28 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C19orf28 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MFSD12 mfsd12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VELTALRYAF TVVANITVYG AAWLLLHLQG SSRVEPTQDI SISDQLGGQD. It is sometimes possible for the material contained within the vial of "C19orf28, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.