Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19587_FCM9.jpg FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of RH35 cells using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Overlay histogram showing RH35 cells stained with AAA19587 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit C1orf77/FOP/CHTOP Polyclonal Antibody | anti-CHTOP antibody

Anti-C1orf77/FOP/CHTOP Antibody Picoband

Gene Names
CHTOP; FOP; SRAG; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG
Reactivity
Human, Monkey, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
C1orf77/FOP/CHTOP, Antibody; Anti-C1orf77/FOP/CHTOP Antibody Picoband; anti-CHTOP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Monkey, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-CHTOP antibody
Western Blot (WB), Immunohistochemistry (IHC), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Monkey, Mouse, Rat
IHC-P: 2-5 ug/ml, Human
FC/FACS: 1-3 ug/1x10^6 cells, Human, Rat
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P).
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human C1orf77/FOP/CHTOP (AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 9. Flow Cytometry analysis of RH35 cells using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Overlay histogram showing RH35 cells stained with AAA19587 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19587_FCM9.jpg FCM (Flow Cytometry) (Figure 9. Flow Cytometry analysis of RH35 cells using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Overlay histogram showing RH35 cells stained with AAA19587 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 8. Flow Cytometry analysis of THP-1 cells using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Overlay histogram showing THP-1 cells stained with AAA19587 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19587_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of THP-1 cells using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Overlay histogram showing THP-1 cells stained with AAA19587 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19587_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19587_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19587_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19587_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19587_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (AAA19587) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(AAA19587-CHTOP-primary-antibodies-IHC-testing-7.jpg)

product-image-AAA19587_IHC2.jpg IHC (Immunohistochemistry) (AAA19587-CHTOP-primary-antibodies-IHC-testing-7.jpg)

WB (Western Blot)

(Figure 1. Western blot analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: monkey COS-7 whole cell lysates,Lane 3: human THP-1 whole cell lysates,Lane 4: human MOLT-4 whole cell lysates,Lane 5: human RT4 whole cell lysates,Lane 6: human HL-60 whole cell lysates,Lane 7: human MCF-7 whole cell lysates,Lane 8: rat brain tissue lysates,Lane 9: rat PC-12 whole cell lysates,Lane 10: mouse spleen tissue lysates,Lane 11: mouse brain tissue lysates,Lane 12: mouse lung tissue lysates,Lane 13: mouse L929 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-C1orf77/FOP/CHTOP antigen affinity purified polyclonal antibody (#AAA19587) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for C1orf77/FOP/CHTOP at approximately 28 kDa. The expected band size for C1orf77/FOP/CHTOP is at 26 kDa.)

product-image-AAA19587_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (AAA19587).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: monkey COS-7 whole cell lysates,Lane 3: human THP-1 whole cell lysates,Lane 4: human MOLT-4 whole cell lysates,Lane 5: human RT4 whole cell lysates,Lane 6: human HL-60 whole cell lysates,Lane 7: human MCF-7 whole cell lysates,Lane 8: rat brain tissue lysates,Lane 9: rat PC-12 whole cell lysates,Lane 10: mouse spleen tissue lysates,Lane 11: mouse brain tissue lysates,Lane 12: mouse lung tissue lysates,Lane 13: mouse L929 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-C1orf77/FOP/CHTOP antigen affinity purified polyclonal antibody (#AAA19587) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for C1orf77/FOP/CHTOP at approximately 28 kDa. The expected band size for C1orf77/FOP/CHTOP is at 26 kDa.)
Related Product Information for anti-CHTOP antibody
This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-CHTOP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,918 Da
NCBI Official Full Name
chromatin target of PRMT1 protein isoform 1
NCBI Official Synonym Full Names
chromatin target of PRMT1
NCBI Official Symbol
CHTOP
NCBI Official Synonym Symbols
FOP; SRAG; SRAG-3; SRAG-5; pp7704; C1orf77; FL-SRAG
NCBI Protein Information
chromatin target of PRMT1 protein
UniProt Protein Name
Chromatin target of PRMT1 protein
UniProt Gene Name
CHTOP
UniProt Synonym Gene Names
C1orf77; FOP; SRAG
UniProt Entry Name
CHTOP_HUMAN

Similar Products

Product Notes

The CHTOP chtop (Catalog #AAA19587) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-C1orf77/FOP/CHTOP Antibody Picoband reacts with Human, Monkey, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1orf77/FOP/CHTOP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Flow Cytometry (FC/FACS). WB: 0.25-0.5 ug/ml, Human, Monkey, Mouse, Rat IHC-P: 2-5 ug/ml, Human FC/FACS: 1-3 ug/1x10^6 cells, Human, Rat Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P). Researchers should empirically determine the suitability of the CHTOP chtop for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1orf77/FOP/CHTOP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.