Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199639_WB13.jpg WB (Western Blot) (WB Suggested Anti-C21orf13 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)

Rabbit anti-Human, Yeast C21orf13 Polyclonal Antibody | anti-LCA5L antibody

C21orf13 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
LCA5L; C21orf13
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C21orf13, Antibody; C21orf13 antibody - N-terminal region; anti-LCA5L antibody
Ordering
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Sequence Length
670
Applicable Applications for anti-LCA5L antibody
WB (Western Blot)
Homology
Human: 100%; Yeast: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C21orf13 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)

product-image-AAA199639_WB13.jpg WB (Western Blot) (WB Suggested Anti-C21orf13 Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)

WB (Western Blot)

(WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

product-image-AAA199639_WB15.jpg WB (Western Blot) (WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-LCA5L antibody
This is a rabbit polyclonal antibody against C21orf13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of the C21orf13 protein remains unknown.
Product Categories/Family for anti-LCA5L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
lebercilin-like protein
NCBI Official Synonym Full Names
lebercilin LCA5 like
NCBI Official Symbol
LCA5L
NCBI Official Synonym Symbols
C21orf13
NCBI Protein Information
lebercilin-like protein
UniProt Protein Name
Lebercilin-like protein
UniProt Gene Name
LCA5L
UniProt Synonym Gene Names
C21orf13
UniProt Entry Name
LCA5L_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LCA5L lca5l (Catalog #AAA199639) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C21orf13 antibody - N-terminal region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's C21orf13 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LCA5L lca5l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLADLTKTNI DEHFFGVALE NNRRSAACKR SPGTGDFSRN SNASNKSVDY. It is sometimes possible for the material contained within the vial of "C21orf13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.