Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200773_WB11.jpg WB (Western Blot) (WB Suggested Anti-C2orf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

Rabbit C2orf3 Polyclonal Antibody | anti-GCFC2 antibody

C2orf3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GCFC2; GCF; TCF9; DNABF; C2orf3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C2orf3, Antibody; C2orf3 antibody - N-terminal region; anti-GCFC2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ
Sequence Length
781
Applicable Applications for anti-GCFC2 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 83%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C2orf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

product-image-AAA200773_WB11.jpg WB (Western Blot) (WB Suggested Anti-C2orf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

WB (Western Blot)

(Host: RabbitTarget Name: GCFC2Sample Type: JurkatAntibody Dilution: 1.0ug/mlGCFC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA200773_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GCFC2Sample Type: JurkatAntibody Dilution: 1.0ug/mlGCFC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: RabbitTarget Name: GCFC2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA200773_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: GCFC2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GCFC2 antibody
This is a rabbit polyclonal antibody against C2orf3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
Product Categories/Family for anti-GCFC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
GC-rich sequence DNA-binding factor 2 isoform 1
NCBI Official Synonym Full Names
GC-rich sequence DNA-binding factor 2
NCBI Official Symbol
GCFC2
NCBI Official Synonym Symbols
GCF; TCF9; DNABF; C2orf3
NCBI Protein Information
GC-rich sequence DNA-binding factor 2
UniProt Protein Name
GC-rich sequence DNA-binding factor 2
UniProt Gene Name
GCFC2
UniProt Synonym Gene Names
C2orf3; GCF; TCF9; TCF-9
UniProt Entry Name
GCFC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GCFC2 gcfc2 (Catalog #AAA200773) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C2orf3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C2orf3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GCFC2 gcfc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEPDDHEKRI PFTLRPQTLR QRMAEESISR NEETSEESQE DEKQDTWEQQ. It is sometimes possible for the material contained within the vial of "C2orf3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.