Rabbit C3ORF10 Polyclonal Antibody | anti-C3ORF10 antibody
C3ORF10 antibody
Gene Names
BRK1; MDS027; hHBrk1; C3orf10; HSPC300
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
C3ORF10, Antibody; C3ORF10 antibody; Polyclonal C3ORF10; Anti-C3ORF10; hHBrk1; Chromosome ORF-3; Chromosome ORF 3; MDS027; HSPC300; Chromosome 3 ORF; anti-C3ORF10 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Clonality
Polyclonal
Specificity
C3ORF10 antibody was raised against the middle region of C3Orf10
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C3ORF10 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
75
Applicable Applications for anti-C3ORF10 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Cross-Reactivity
Human,Mouse,Rat,Dog,ZebraFish
Immunogen
C3ORF10 antibody was raised using the middle region of C3Orf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-C3ORF10 antibody
Rabbit polyclonal C3ORF10 antibody raised against the middle region of C3Orf10
Product Categories/Family for anti-C3ORF10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
9 kDa (MW of target protein)
NCBI Official Full Name
chromosome 3 open reading frame 10, isoform CRA_b
NCBI Official Synonym Full Names
BRICK1, SCAR/WAVE actin-nucleating complex subunit
NCBI Official Symbol
BRK1
NCBI Official Synonym Symbols
MDS027; hHBrk1; C3orf10; HSPC300
NCBI Protein Information
protein BRICK1
UniProt Protein Name
Protein BRICK1
UniProt Gene Name
BRK1
UniProt Synonym Gene Names
C3orf10; BRK1
UniProt Entry Name
BRK1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The C3ORF10 brk1 (Catalog #AAA224229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3ORF10 antibody reacts with Human, Mouse, Rat, Dog, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C3ORF10 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the C3ORF10 brk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C3ORF10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
