Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198897_WB13.jpg WB (Western Blot) (WB Suggested Anti-C4BPA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit anti-Human C4BPA Polyclonal Antibody | anti-C4BPA antibody

C4BPA antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
C4BPA; PRP; C4BP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C4BPA, Antibody; C4BPA antibody - middle region; anti-C4BPA antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Sequence Length
597
Applicable Applications for anti-C4BPA antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C4BPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-C4BPA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

product-image-AAA198897_WB13.jpg WB (Western Blot) (WB Suggested Anti-C4BPA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: C4BPASample Type: HepG2 Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

product-image-AAA198897_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: C4BPASample Type: HepG2 Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)
Related Product Information for anti-C4BPA antibody
This is a rabbit polyclonal antibody against C4BPA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
722
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
C4b-binding protein alpha chain
NCBI Official Synonym Full Names
complement component 4 binding protein alpha
NCBI Official Symbol
C4BPA
NCBI Official Synonym Symbols
PRP; C4BP
NCBI Protein Information
C4b-binding protein alpha chain
UniProt Protein Name
C4b-binding protein alpha chain
UniProt Gene Name
C4BPA
UniProt Synonym Gene Names
C4BP; C4bp; PRP
UniProt Entry Name
C4BPA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The C4BPA c4bpa (Catalog #AAA198897) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C4BPA antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C4BPA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the C4BPA c4bpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVLTGKRLMQ CLPNPEDVKM ALEVYKLSLE IEQLELQRDS ARQSTLDKEL. It is sometimes possible for the material contained within the vial of "C4BPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.