Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200814_WB13.jpg WB (Western Blot) (WB Suggested Anti-CA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit CA1 Polyclonal Antibody | anti-CA1 antibody

CA1 antibody - N-terminal region

Gene Names
CA1; CAB; CA-I; Car1; HEL-S-11
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CA1, Antibody; CA1 antibody - N-terminal region; anti-CA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS
Sequence Length
261
Applicable Applications for anti-CA1 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Pig: 100%; Rat: 79%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

product-image-AAA200814_WB13.jpg WB (Western Blot) (WB Suggested Anti-CA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: CA1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA200814_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CA1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CA1 antibody
This is a rabbit polyclonal antibody against CA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.
Product Categories/Family for anti-CA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
759
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
carbonic anhydrase 1 isoform a
NCBI Official Synonym Full Names
carbonic anhydrase 1
NCBI Official Symbol
CA1
NCBI Official Synonym Symbols
CAB; CA-I; Car1; HEL-S-11
NCBI Protein Information
carbonic anhydrase 1
UniProt Protein Name
Carbonic anhydrase 1
UniProt Gene Name
CA1
UniProt Synonym Gene Names
CAB; CA-I
UniProt Entry Name
CAH1_HUMAN

Similar Products

Product Notes

The CA1 ca1 (Catalog #AAA200814) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CA1 ca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASPDWGYDDK NGPEQWSKLY PIANGNNQSP VDIKTSETKH DTSLKPISVS. It is sometimes possible for the material contained within the vial of "CA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.