Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281824_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using CA5B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit CA5B Polyclonal Antibody | anti-CA5B antibody

CA5B Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CA5B; CA-VB
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
CA5B, Antibody; CA5B Rabbit pAb; CA5B; CA-VB; anti-CA5B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Applicable Applications for anti-CA5B antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-317 of human CA5B (NP_009151.1).
Positive Samples
A-549, Mouse kidney, Mouse lung, Mouse spleen, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using CA5B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281824_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using CA5B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CA5B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281824_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CA5B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CA5B antibody
Background: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles. [provided by RefSeq, Jul 2008]
Product Categories/Family for anti-CA5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,434 Da
NCBI Official Full Name
carbonic anhydrase 5B, mitochondrial
NCBI Official Synonym Full Names
carbonic anhydrase VB, mitochondrial
NCBI Official Symbol
CA5B
NCBI Official Synonym Symbols
CA-VB
NCBI Protein Information
carbonic anhydrase 5B, mitochondrial; carbonic dehydratase; carbonate dehydratase VB
UniProt Protein Name
Carbonic anhydrase 5B, mitochondrial
UniProt Gene Name
CA5B
UniProt Synonym Gene Names
CA-VB
UniProt Entry Name
CAH5B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CA5B ca5b (Catalog #AAA281824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA5B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CA5B can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CA5B ca5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVVMNSLRVI LQASPGKLLW RKFQIPRFMP ARPCSLYTCT YKTRNRALHP LWESVDLVPG GDRQSPINIR WRDSVYDPGL KPLTISYDPA TCLHVWNNGY SFLVEFEDST DKSVIKGGPL EHNYRLKQFH FHWGAIDAWG SEHTVDSKCF PAELHLVHWN AVRFENFEDA ALEENGLAVI GVFLKLGKHH KELQKLVDTL PSIKHKDALV EFGSFDPSCL MPTCPDYWTY SGSLTTPPLS ESVTWIIKKQ PVEVDHDQLE QFRTLLFTSE GEKEKRMVDN FRPLQPLMNR TVRSSFRHDY VLNVQAKPKP ATSQATP. It is sometimes possible for the material contained within the vial of "CA5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.