Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198198_WB11.jpg WB (Western Blot) (WB Suggested Anti-CACNG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit CACNG1 Polyclonal Antibody | anti-CACNG1 antibody

CACNG1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CACNG1; CACNLG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CACNG1, Antibody; CACNG1 antibody - N-terminal region; anti-CACNG1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL
Sequence Length
222
Applicable Applications for anti-CACNG1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CACNG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

product-image-AAA198198_WB11.jpg WB (Western Blot) (WB Suggested Anti-CACNG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CACNG1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA198198_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CACNG1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CACNG1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA198198_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CACNG1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)
Related Product Information for anti-CACNG1 antibody
This is a rabbit polyclonal antibody against CACNG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
786
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
voltage-dependent calcium channel gamma-1 subunit
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit gamma 1
NCBI Official Symbol
CACNG1
NCBI Official Synonym Symbols
CACNLG
NCBI Protein Information
voltage-dependent calcium channel gamma-1 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-1 subunit
UniProt Gene Name
CACNG1
UniProt Synonym Gene Names
CACNLG
UniProt Entry Name
CCG1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CACNG1 cacng1 (Catalog #AAA198198) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACNG1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CACNG1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CACNG1 cacng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKTCGPITLP GEKNCSYFRH FNPGESSEIF EFTTQKEYSI SAAAIAIFSL. It is sometimes possible for the material contained within the vial of "CACNG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.