Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23590_WB6.jpg WB (Western Blot) (Sample Type: Human COLO205CALB1 antibody - C-terminal region validated by WB using COLO205 cells lysate at 1ug/ml.)

Rabbit CALB1 Polyclonal Antibody | anti-CALB1 antibody

CALB1 antibody - C-terminal region

Gene Names
CALB1; CALB; D-28K
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CALB1, Antibody; CALB1 antibody - C-terminal region; anti-CALB1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM
Sequence Length
261
Applicable Applications for anti-CALB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CALB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Sample Type: Human COLO205CALB1 antibody - C-terminal region validated by WB using COLO205 cells lysate at 1ug/ml.)

product-image-AAA23590_WB6.jpg WB (Western Blot) (Sample Type: Human COLO205CALB1 antibody - C-terminal region validated by WB using COLO205 cells lysate at 1ug/ml.)

IHC (Immunohistochemistry)

(Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit Alexa 488Secondary Antibody Dilution :1:500Gene Name :CALB1Submitted by :Anonymous)

product-image-AAA23590_IHC5.jpg IHC (Immunohistochemistry) (Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit Alexa 488Secondary Antibody Dilution :1:500Gene Name :CALB1Submitted by :Anonymous)

IHC (Immunohistochemistry)

(Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit Alexa 488Secondary Antibody Dilution :1:500Gene Name :CALB1Submitted by :Anonymous)

product-image-AAA23590_IHC4.jpg IHC (Immunohistochemistry) (Primary Antibody Dilution :1:500Secondary Antibody :Donkey anti-rabbit Alexa 488Secondary Antibody Dilution :1:500Gene Name :CALB1Submitted by :Anonymous)

IHC (Immunohistochemistry)

(Sample Type: human purkinje fibersCALB1 Antibody tested in Purkinje neurons in human cerebellum> Calbindin 1 was detected using HRP/DAB brown color stain.)

product-image-AAA23590_IHC3.jpg IHC (Immunohistochemistry) (Sample Type: human purkinje fibersCALB1 Antibody tested in Purkinje neurons in human cerebellum> Calbindin 1 was detected using HRP/DAB brown color stain.)

IHC (Immunohistochemistry)

(Sample Type: TadpoleSpecies+tissue/cell type: Tadpole forebrain horizontal sectionPrimary antibody dilution: 1:500Secondary antibody: Donkey anti-rabbit Alexa 488Secondary antibody dilution: 1:500)

product-image-AAA23590_IHC2.jpg IHC (Immunohistochemistry) (Sample Type: TadpoleSpecies+tissue/cell type: Tadpole forebrain horizontal sectionPrimary antibody dilution: 1:500Secondary antibody: Donkey anti-rabbit Alexa 488Secondary antibody dilution: 1:500)

IHC (Immunohistochemistry)

(Sample Type: TadpoleApplication: IHCSpecies+tissue/cell type: Tadpole tegmenta horizontal sectionPrimary antibody dilution: 1:500Secondary antibody: Donkey anti-rabbit Alexa 488Secondary antibody dilution: 1:500)

product-image-AAA23590_IHC.jpg IHC (Immunohistochemistry) (Sample Type: TadpoleApplication: IHCSpecies+tissue/cell type: Tadpole tegmenta horizontal sectionPrimary antibody dilution: 1:500Secondary antibody: Donkey anti-rabbit Alexa 488Secondary antibody dilution: 1:500)
Related Product Information for anti-CALB1 antibody
This is a rabbit polyclonal antibody against CALB1. It was validated on Western Blot

Target Description: Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted.
Product Categories/Family for anti-CALB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
793
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
calbindin isoform 1
NCBI Official Synonym Full Names
calbindin 1
NCBI Official Symbol
CALB1
NCBI Official Synonym Symbols
CALB; D-28K
NCBI Protein Information
calbindin
UniProt Protein Name
Calbindin
UniProt Gene Name
CALB1
UniProt Synonym Gene Names
CAB27
UniProt Entry Name
CALB1_HUMAN

Similar Products

Product Notes

The CALB1 calb1 (Catalog #AAA23590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALB1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CALB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CALB1 calb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFNKAFELYD QDGNGYIDEN ELDALLKDLC EKNKQDLDIN NITTYKKNIM. It is sometimes possible for the material contained within the vial of "CALB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.