WB (Western Blot)
(Calpain 4 antibody (AAA108332) used at 1 ug/ml to detect target protein.)
Rabbit Calpain 4 Polyclonal Antibody
Calpain 4 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
Calpain 4, Antibody; Calpain 4 antibody; Polyclonal Calpain 4; Anti-Calpain 4; CAPN4; CALPAIN4; 30K; Calpain Small Subunit 1; CDPS; CAPNS1; CANPS; CANP; anti-Calpain 4 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Calpain 4 antibody was raised against the middle region of CAPNS1
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1X PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Applicable Applications for anti-Calpain 4 antibody
WB (Western Blot)
Biological Significance
Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.
Cross-Reactivity
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit , Sheep
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAPNS1
Implications in Disease
Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
Preparation and Storage
Store at 4°C short term
Store at -20°C long term. Avoid repeat freeze-thaws.
Store at -20°C long term. Avoid repeat freeze-thaws.
WB (Western Blot)
(Calpain 4 antibody (AAA108332) used at 1 ug/ml to detect target protein.)
WB (Western Blot)
(Calpain 4 antibody (AAA108332) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-Calpain 4 antibody
Rabbit polyclonal Calpain 4 antibody raised against the middle region of CAPNS1
Calpain 4 Blocking Peptide, (please inquire) is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody.
This is a rabbit polyclonal antibody against CAPNS1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest.
Calpain 4 Blocking Peptide, (please inquire) is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody.
This is a rabbit polyclonal antibody against CAPNS1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest.
Product Categories/Family for anti-Calpain 4 antibody
Similar Products
Product Notes
The Calpain 4 (Catalog #AAA108332) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Calpain 4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Calpain 4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Calpain 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.