Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28363_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Calreticulin Polyclonal Antibody | anti-CALR antibody

[KO Validated] Calreticulin Rabbit pAb

Gene Names
CALR; RO; CRT; SSA; cC1qR
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Purity
Affinity purification
Synonyms
Calreticulin, Antibody; [KO Validated] Calreticulin Rabbit pAb; CALR; CRT; HEL-S-99n; RO; SSA; cC1qR; anti-CALR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Applicable Applications for anti-CALR antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), IP (Immunoprecipitation)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:100
IP: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 18-417 of human Calreticulineticulin (NP_004334.1).
Cellular Location
Cell surface, Cytoplasm, Endoplasmic reticulum lumen, Sarcoplasmic reticulum lumen, Secreted, cytosol, extracellular matrix, extracellular space
Positive Samples
NIH/3T3, SH-SY5Y, Mouse liver, Rat liver, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28363_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28363_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28363_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Calreticulin Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded human brain using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28363_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded human brain using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28363_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human thyroid cancer using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28363_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human thyroid cancer using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28363_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] Calreticulineticulin Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Calreticulineticulin antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28363_WB2.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Calreticulineticulin antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and Calreticulineticulin knockout (KO) HeLa cells, using Calreticulineticulin antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA28363_WB.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and Calreticulineticulin knockout (KO) HeLa cells, using Calreticulineticulin antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-CALR antibody
Background: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors.
Product Categories/Family for anti-CALR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
811
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,142 Da
NCBI Official Full Name
calreticulin
NCBI Official Synonym Full Names
calreticulin
NCBI Official Symbol
CALR
NCBI Official Synonym Symbols
RO; CRT; SSA; cC1qR
NCBI Protein Information
calreticulin; CRP55; ERp60; HACBP; grp60; calregulin; endoplasmic reticulum resident protein 60; Sicca syndrome antigen A (autoantigen Ro; calreticulin)
UniProt Protein Name
Calreticulin
UniProt Gene Name
CALR
UniProt Synonym Gene Names
CRTC; ERp60
UniProt Entry Name
CALR_HUMAN

Similar Products

Product Notes

The CALR calr (Catalog #AAA28363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Calreticulin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Calreticulin can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), IP (Immunoprecipitation). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:100 IP: 1:50-1:200. Researchers should empirically determine the suitability of the CALR calr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EPAVYFKEQF LDGDGWTSRW IESKHKSDFG KFVLSSGKFY GDEEKDKGLQ TSQDARFYAL SASFEPFSNK GQTLVVQFTV KHEQNIDCGG GYVKLFPNSL DQTDMHGDSE YNIMFGPDIC GPGTKKVHVI FNYKGKNVLI NKDIRCKDDE FTHLYTLIVR PDNTYEVKID NSQVESGSLE DDWDFLPPKK IKDPDASKPE DWDERAKIDD PTDSKPEDWD KPEHIPDPDA KKPEDWDEEM DGEWEPPVIQ NPEYKGEWKP RQIDNPDYKG TWIHPEIDNP EYSPDPSIYA YDNFGVLGLD LWQVKSGTIF DNFLITNDEA YAEEFGNETW GVTKAAEKQM KDKQDEEQRL KEEEEDKKRK EEEEAEDKED DEDKDEDEED EEDKEEDEEE DVPGQAKDEL. It is sometimes possible for the material contained within the vial of "Calreticulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.