Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282289_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat bone marrow cells using CAMP antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Rat CAMP Polyclonal Antibody | anti-CAMP antibody

CAMP Rabbit pAb

Gene Names
GPR68; OGR1; GPR12A
Reactivity
Human, Rat
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CAMP, Antibody; CAMP Rabbit pAb; CAMP; CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37; anti-CAMP antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
Applicable Applications for anti-CAMP antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-170 of human CAMP (NP_004336.4).
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of rat bone marrow cells using CAMP antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282289_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat bone marrow cells using CAMP antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human appendix using CAMP antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282289_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human appendix using CAMP antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat bone marrow using CAMP antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282289_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat bone marrow using CAMP antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-CAMP antibody
This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014]
Product Categories/Family for anti-CAMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,077 Da
NCBI Official Full Name
ovarian cancer G-protein coupled receptor 1
NCBI Official Synonym Full Names
G protein-coupled receptor 68
NCBI Official Symbol
GPR68
NCBI Official Synonym Symbols
OGR1; GPR12A
NCBI Protein Information
ovarian cancer G-protein coupled receptor 1; G-protein coupled receptor 68; sphingosylphosphorylcholine receptor; ovarian cancer G protein-coupled receptor, 1
UniProt Protein Name
Ovarian cancer G-protein coupled receptor 1
UniProt Gene Name
GPR68
UniProt Synonym Gene Names
OGR1; OGR-1
UniProt Entry Name
OGR1_HUMAN

Similar Products

Product Notes

The CAMP gpr68 (Catalog #AAA282289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMP Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAMP can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CAMP gpr68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SFNCVADPVL YCFVSETTHR DLARLRGACL AFLTCSRTGR AREAYPLGAP EASGKSGAQG EEPELLTKLH PAFQTPNSPG SGGFPTGRLA. It is sometimes possible for the material contained within the vial of "CAMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.