<
WB (Western Blot)
(Primary dilution: 1ug/mL Secondary dilution: 1:2000Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells)
Rabbit CAPN1 Polyclonal Antibody | anti-CAPN1 antibody
CAPN1 antibody - middle region
Gene Names
CAPN1; CANP; muCL; CANP1; SPG76; CANPL1; muCANP
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CAPN1, Antibody; CAPN1 antibody - middle region; anti-CAPN1 antibody
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
Sequence Length
714
Applicable Applications for anti-CAPN1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 79%; Goat: 79%; Horse: 93%; Human: 100%; Mouse: 80%; Pig: 86%; Rabbit: 79%; Rat: 83%; Sheep: 79%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAPN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Primary dilution: 1ug/mL Secondary dilution: 1:2000Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells)
WB (Western Blot)
(Primary dilution: 1ug/mL Secondary dilution: 1:2000Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells)
WB (Western Blot)
(Lanes:1. 20 ug Jurkat cell lysate2. 20 ug Hut-78 cell lysate3. 20 ug K562 cell lysate4. 20 ug Raj cell lysate5. 20 ug U937 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:CAPN1Submitted by:Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland)
WB (Western Blot)
(Lanes:1. 20 ug Jurkat cell lysate2. 20 ug Hut-78 cell lysate3. 20 ug K562 cell lysate4. 20 ug Raj cell lysate5. 20 ug U937 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:CAPN1Submitted by:Ewelina Swiderek, Institute of Immunology and Experimental Therapy, Wroclaw, Poland)
WB (Western Blot)
(Sample Type: Human HT1080CAPN1 antibody - middle region validated by WB using HT1080 cell lysate at 1ug/mL.)
WB (Western Blot)
(Sample Type: Human HT1080CAPN1 antibody - middle region validated by WB using HT1080 cell lysate at 1ug/mL.)
IHC (Immunohistochemistry)
(Rabbit Anti-CAPN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-CAPN1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CAPN1 antibody
This is a rabbit polyclonal antibody against CAPN1. It was validated on Western Blot
Target Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Target Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-CAPN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
calpain-1 catalytic subunit
NCBI Official Synonym Full Names
calpain 1
NCBI Official Symbol
CAPN1
NCBI Official Synonym Symbols
CANP; muCL; CANP1; SPG76; CANPL1; muCANP
NCBI Protein Information
calpain-1 catalytic subunit
UniProt Protein Name
Calpain-1 catalytic subunit
UniProt Gene Name
CAPN1
UniProt Synonym Gene Names
CANPL1; CANP 1; muCANP
UniProt Entry Name
CAN1_HUMAN
Similar Products
Product Notes
The CAPN1 capn1 (Catalog #AAA201038) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN1 antibody - middle region reacts with Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CAPN1 capn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVEWTGAWSD SSSEWNNVDP YERDQLRVKM EDGEFWMSFR DFMREFTRLE. It is sometimes possible for the material contained within the vial of "CAPN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.