Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201567_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CARD11Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CARD11 Polyclonal Antibody | anti-CARD11 antibody

CARD11 Antibody - middle region

Gene Names
CARD11; PPBL; BENTA; BIMP3; IMD11; CARMA1; IMD11A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CARD11, Antibody; CARD11 Antibody - middle region; anti-CARD11 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSL
Sequence Length
1171
Applicable Applications for anti-CARD11 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CARD11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CARD11Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201567_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CARD11Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CARD11Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA201567_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: CARD11Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-CARD11 antibody
The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128 kDa
NCBI Official Full Name
caspase recruitment domain-containing protein 11
NCBI Official Synonym Full Names
caspase recruitment domain family member 11
NCBI Official Symbol
CARD11
NCBI Official Synonym Symbols
PPBL; BENTA; BIMP3; IMD11; CARMA1; IMD11A
NCBI Protein Information
caspase recruitment domain-containing protein 11

Similar Products

Product Notes

The CARD11 (Catalog #AAA201567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARD11 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CARD11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CARD11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPRLSRASFL FGQLLQFVSR SENKYKRMNS NERVRIISGS PLGSLARSSL. It is sometimes possible for the material contained within the vial of "CARD11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.