Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282274_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using CARTPT antibody at dilution of 1:100 (40x lens).)

Rabbit CARTPT Polyclonal Antibody | anti-CARTPT antibody

CARTPT Rabbit pAb

Gene Names
FOSL1; FRA; FRA1; fra-1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
CARTPT, Antibody; CARTPT Rabbit pAb; CART; CARTPT; anti-CARTPT antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
Applicable Applications for anti-CARTPT antibody
IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CARTPT (NP_004282.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse brain using CARTPT antibody at dilution of 1:100 (40x lens).)

product-image-AAA282274_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using CARTPT antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using CARTPT antibody at dilution of 1:100 (40x lens).)

product-image-AAA282274_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using CARTPT antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using CARTPT antibody at dilution of 1:100 (40x lens).)

product-image-AAA282274_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using CARTPT antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-CARTPT antibody
This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,413 Da
NCBI Official Full Name
fos-related antigen 1
NCBI Official Synonym Full Names
FOS-like antigen 1
NCBI Official Symbol
FOSL1
NCBI Official Synonym Symbols
FRA; FRA1; fra-1
NCBI Protein Information
fos-related antigen 1; FOS-like antigen-1
UniProt Protein Name
Fos-related antigen 1
UniProt Gene Name
FOSL1
UniProt Synonym Gene Names
FRA1; FRA-1
UniProt Entry Name
FOSL1_HUMAN

Similar Products

Product Notes

The CARTPT fosl1 (Catalog #AAA282274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARTPT Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CARTPT can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CARTPT fosl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFRDFGEPGP SSGNGGGYGG PAQPPAAAQA AQQKFHLVPS INTMSGSQEL QWMVQPHFLG PSSYPRPLTY PQYSPPQPRP GVIRALGPPP GVRRRPCEQI. It is sometimes possible for the material contained within the vial of "CARTPT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.