Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281793_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse testis using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit Casein Kinase 2 beta (CSNK2B) Polyclonal Antibody | anti-CSNK2B antibody

Casein Kinase 2 beta (CSNK2B) Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CSNK2B; G5A; CK2B; CK2N; CSK2B
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Casein Kinase 2 beta (CSNK2B), Antibody; Casein Kinase 2 beta (CSNK2B) Rabbit pAb; CK2B; CK2N; CSK2B; G5A; CSNK2B; Ckb1; Ckb2; anti-CSNK2B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Applicable Applications for anti-CSNK2B antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B))(NP_001311.3).
Positive Samples
SW620, HeLa, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse testis using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281793_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse testis using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human thyroid cancer using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281793_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human thyroid cancer using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat lung using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281793_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat lung using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281793_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-CSNK2B antibody
Background: This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,942 Da
NCBI Official Full Name
casein kinase II subunit beta
NCBI Official Synonym Full Names
casein kinase 2, beta polypeptide
NCBI Official Symbol
CSNK2B
NCBI Official Synonym Symbols
G5A; CK2B; CK2N; CSK2B
NCBI Protein Information
casein kinase II subunit beta; phosvitin; CK II beta; protein G5a; Casein kinase II beta subunit; alternative name: G5a, phosvitin
UniProt Protein Name
Casein kinase II subunit beta
UniProt Gene Name
CSNK2B
UniProt Synonym Gene Names
CK2N; G5A; CK II beta
UniProt Entry Name
CSK2B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CSNK2B csnk2b (Catalog #AAA281793) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Casein Kinase 2 beta (CSNK2B) Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Casein Kinase 2 beta (CSNK2B) can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CSNK2B csnk2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSSEEVSWI SWFCGLRGNE FFCEVDEDYI QDKFNLTGLN EQVPHYRQAL DMILDLEPDE ELEDNPNQSD LIEQAAEMLY GLIHARYILT NRGIAQMLEK YQQGDFGYCP RVYCENQPML PIGLSDIPGE AMVKLYCPKC MDVYTPKSSR HHHTDGAYFG TGFPHMLFMV HPEYRPKRPA NQFVPRLYGF KIHPMAYQLQ LQAASNFKSP VKTIR. It is sometimes possible for the material contained within the vial of "Casein Kinase 2 beta (CSNK2B), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.