Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200886_WB13.jpg WB (Western Blot) (WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateCASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit CASP1 Polyclonal Antibody | anti-CASP1 antibody

CASP1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CASP1; ICE; P45; IL1BC
Reactivity
Horse, Human, Rabbit, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CASP1, Antibody; CASP1 antibody - middle region; anti-CASP1 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Sequence Length
383
Applicable Applications for anti-CASP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Horse: 79%; Human: 100%; Rabbit: 79%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CASP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateCASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA200886_WB13.jpg WB (Western Blot) (WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateCASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohistochemistry)

(Rabbit Anti-CASP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200886_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-CASP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CASP1 antibody
This is a rabbit polyclonal antibody against CASP1. It was validated on Western Blot

Target Description: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.
Product Categories/Family for anti-CASP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
834
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
caspase-1 isoform beta
NCBI Official Synonym Full Names
caspase 1
NCBI Official Symbol
CASP1
NCBI Official Synonym Symbols
ICE; P45; IL1BC
NCBI Protein Information
caspase-1
UniProt Protein Name
Caspase-1
UniProt Gene Name
CASP1
UniProt Synonym Gene Names
IL1BC; IL1BCE; CASP-1; IL-1BC; ICE
UniProt Entry Name
CASP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CASP1 casp1 (Catalog #AAA200886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP1 antibody - middle region reacts with Horse, Human, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CASP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CASP1 casp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQTRVLNKEE MEKVKRENAT VMDKTRALID SVIPKGAQAC QICITYICEE. It is sometimes possible for the material contained within the vial of "CASP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.