Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281696_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse heart using CASQ2 antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Mouse, Rat CASQ2 Polyclonal Antibody | anti-CASQ2 antibody

CASQ2 Rabbit pAb

Gene Names
CASQ2; PDIB2
Reactivity
Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CASQ2, Antibody; CASQ2 Rabbit pAb; CASQ2; PDIB2; anti-CASQ2 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Applicable Applications for anti-CASQ2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-399 of human CASQ2 (NP_001223.2).
Positive Samples
Mouse heart, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using CASQ2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281696_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse heart using CASQ2 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CASQ2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281696_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CASQ2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-CASQ2 antibody
Background: The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
845
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,269 Da
NCBI Official Full Name
calsequestrin-2
NCBI Official Synonym Full Names
calsequestrin 2 (cardiac muscle)
NCBI Official Symbol
CASQ2
NCBI Official Synonym Symbols
PDIB2
NCBI Protein Information
calsequestrin-2; calsequestrin 2, fast-twitch, cardiac muscle; calsequestrin, cardiac muscle isoform
UniProt Protein Name
Calsequestrin-2
UniProt Gene Name
CASQ2
UniProt Entry Name
CASQ2_HUMAN

Similar Products

Product Notes

The CASQ2 casq2 (Catalog #AAA281696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASQ2 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CASQ2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CASQ2 casq2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEGLNFPTYD GKDRVVSLSE KNFKQVLKKY DLLCLYYHEP VSSDKVTQKQ FQLKEIVLEL VAQVLEHKAI GFVMVDAKKE AKLAKKLGFD EEGSLYILKG DRTIEFDGEF AADVLVEFLL DLIEDPVEII SSKLEVQAFE RIEDYIKLIG FFKSEDSEYY KAFEEAAEHF QPYIKFFATF DKGVAKKLSL KMNEVDFYEP FMDEPIAIPN KPYTEEELVE FVKEHQRPTL RRLRPEEMFE TWEDDLNGIH IVAFAEKSDP DGYEFLEILK QVARDNTDNP DLSILWIDPD DFPLLVAYWE KTFKIDLFRP QIGVVNVTDA DSVWMEIPDD DDLPTAEELE DWIEDVLSGK INTEDDDEDD DDDDNSDEED NDDSDDDDDE. It is sometimes possible for the material contained within the vial of "CASQ2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.