Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201698_WB11.jpg WB (Western Blot) (WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit CAV2 Polyclonal Antibody | anti-CAV2 antibody

CAV2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CAV2; CAV
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CAV2, Antibody; CAV2 antibody - N-terminal region; anti-CAV2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
Sequence Length
162
Applicable Applications for anti-CAV2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

product-image-AAA201698_WB11.jpg WB (Western Blot) (WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

WB (Western Blot)

(Lanes:Lane1: 50 ug human placental tissue lysateLane2: 40 ug human placental tissue lysateLane3: 30 ug human placental tissue lysateLane4: 20 ug human placental tissue lysateLane5: 20 ug human myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Caveolin 2Submitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)

product-image-AAA201698_WB13.jpg WB (Western Blot) (Lanes:Lane1: 50 ug human placental tissue lysateLane2: 40 ug human placental tissue lysateLane3: 30 ug human placental tissue lysateLane4: 20 ug human placental tissue lysateLane5: 20 ug human myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Caveolin 2Submitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)

IHC (Immunohistochemistry)

(Sample Type :Human placental tissue Primary Antibody Dilution :1:50Secondary Antibody :Goat anti rabbit-HRP Secondary Antibody Dilution :1:10,000Color/Signal Descriptions :Brown: CAV2Purple: HaemotoxylinGene Name :CAV2Submitted by :Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham)

product-image-AAA201698_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human placental tissue Primary Antibody Dilution :1:50Secondary Antibody :Goat anti rabbit-HRP Secondary Antibody Dilution :1:10,000Color/Signal Descriptions :Brown: CAV2Purple: HaemotoxylinGene Name :CAV2Submitted by :Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham)
Related Product Information for anti-CAV2 antibody
This is a rabbit polyclonal antibody against CAV2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
Product Categories/Family for anti-CAV2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
858
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
caveolin-2 isoform a
NCBI Official Synonym Full Names
caveolin 2
NCBI Official Symbol
CAV2
NCBI Official Synonym Symbols
CAV
NCBI Protein Information
caveolin-2
UniProt Protein Name
Caveolin-2
UniProt Gene Name
CAV2
UniProt Entry Name
CAV2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CAV2 cav2 (Catalog #AAA201698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAV2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CAV2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CAV2 cav2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVIPYNEKPE KPAKTQKTSL DEALQWRDSL DKLLQNNYGL ASFKSFLKSE. It is sometimes possible for the material contained within the vial of "CAV2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.