Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281115_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug CCAR1 antibody. Western blot was performed from the immunoprecipitate using CCAR1 antibody at a dilition of 1:500.)

Rabbit anti-Human CCAR1 Polyclonal Antibody | anti-CCAR1 antibody

CCAR1 Polyclonal Antibody

Reactivity
Human
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
CCAR1, Antibody; CCAR1 Polyclonal Antibody; anti-CCAR1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKW
Sequence Length
1135
Applicable Applications for anti-CCAR1 antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human CCAR1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, perinuclear region
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug CCAR1 antibody. Western blot was performed from the immunoprecipitate using CCAR1 antibody at a dilition of 1:500.)

product-image-AAA281115_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug CCAR1 antibody. Western blot was performed from the immunoprecipitate using CCAR1 antibody at a dilition of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using CCAR1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281115_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using CCAR1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CCAR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281115_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CCAR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Product Categories/Family for anti-CCAR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 131kDa; 132kDa
Observed: 155kDa
NCBI Official Full Name
cell division cycle and apoptosis regulator protein 1 isoform b
NCBI Official Synonym Full Names
cell division cycle and apoptosis regulator 1
NCBI Official Symbol
CCAR1
NCBI Protein Information
cell division cycle and apoptosis regulator protein 1
UniProt Protein Name
Cell division cycle and apoptosis regulator protein 1
UniProt Gene Name
CCAR1
UniProt Synonym Gene Names
CARP1; DIS; CARP-1

Similar Products

Product Notes

The CCAR1 ccar1 (Catalog #AAA281115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCAR1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCAR1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CCAR1 ccar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQFGGQKNP PWATQFTATA VSQPAALGVQ QPSLLGASPT IYTQQTALAA AGLTTQTPAN YQLTQTAALQ QQAAAAAAAL QQQYSQPQQA LYSVQQQLQQ PQQTLLTQPA VALPTSLSLS TPQPTAQITV SYPTPRSSQQ QTQPQKQRVF TGVVTKLHDT FGFVDEDVFF QLSAVKGKTP QVGDRVLVEA TYNPNMPFKW. It is sometimes possible for the material contained within the vial of "CCAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.