Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197575_SDS_PAGE8.jpg SDS-PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel.3 ug/mL of the antibody was used in this experiment.)

Rabbit CCND1 Polyclonal Antibody | anti-CCND1 antibody

CCND1 antibody - N-terminal region

Gene Names
CCND1; BCL1; PRAD1; U21B31; D11S287E
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CCND1, Antibody; CCND1 antibody - N-terminal region; anti-CCND1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTA
Sequence Length
295
Applicable Applications for anti-CCND1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (#AA)
295 amino acids
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCND1
Preparation and Storage
For short term use, store at 2-8 degrees C up to 1 week. For long term storage, store at -20 degrees C in small aliquots to prevent freeze-thaw cycles.

SDS-PAGE

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel.3 ug/mL of the antibody was used in this experiment.)

product-image-AAA197575_SDS_PAGE8.jpg SDS-PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel.3 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(WB Suggested Anti-CCND1 antibody Titration: 1 ug/mLSample Type: Human SH-SY5Y)

product-image-AAA197575_WB10.jpg WB (Western Blot) (WB Suggested Anti-CCND1 antibody Titration: 1 ug/mLSample Type: Human SH-SY5Y)

WB (Western Blot)

(WB Suggested Anti-CCND1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

product-image-AAA197575_WB11.jpg WB (Western Blot) (WB Suggested Anti-CCND1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: CCND1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197575_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CCND1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Testis)

product-image-AAA197575_IHC15.jpg IHC (Immunohistochemistry) (Testis)
Related Product Information for anti-CCND1 antibody
This is a rabbit polyclonal antibody against CCND1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CCND1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
595
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
G1/S-specific cyclin-D1
NCBI Official Synonym Full Names
cyclin D1
NCBI Official Symbol
CCND1
NCBI Official Synonym Symbols
BCL1; PRAD1; U21B31; D11S287E
NCBI Protein Information
G1/S-specific cyclin-D1
UniProt Protein Name
G1/S-specific cyclin-D1
UniProt Gene Name
CCND1
UniProt Synonym Gene Names
BCL1; PRAD1; BCL-1
UniProt Entry Name
CCND1_HUMAN

Similar Products

Product Notes

The CCND1 ccnd1 (Catalog #AAA197575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCND1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCND1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CCND1 ccnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCEEEVFPLA MNYLDRFLSL EPVKKSRLQL LGATCMFVAS KMKETIPLTA. It is sometimes possible for the material contained within the vial of "CCND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.