WB (Western Blot)
(WB Suggested Anti-CCNG2 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit CCNG2 Polyclonal Antibody | anti-CCNG2 antibody
CCNG2 antibody - N-terminal region
Reactivity
Cow, Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CCNG2, Antibody; CCNG2 antibody - N-terminal region; anti-CCNG2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
Sequence Length
344
Applicable Applications for anti-CCNG2 antibody
WB (Western Blot)
Homology
Cow: 91%; Dog: 91%; Human: 100%; Mouse: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-CCNG2 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-CCNG2 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: CCNG2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CCNG2Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CCNG2 antibody
This is a rabbit polyclonal antibody against CCNG2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.
Target Description: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.
Product Categories/Family for anti-CCNG2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
cyclin-G2
NCBI Official Synonym Full Names
cyclin G2
NCBI Official Symbol
CCNG2
NCBI Protein Information
cyclin-G2
UniProt Protein Name
Cyclin-G2
UniProt Gene Name
CCNG2
UniProt Entry Name
CCNG2_HUMAN
Similar Products
Product Notes
The CCNG2 ccng2 (Catalog #AAA201681) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNG2 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCNG2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCNG2 ccng2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT. It is sometimes possible for the material contained within the vial of "CCNG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.