Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200809_WB15.jpg WB (Western Blot) (WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit CCR2 Polyclonal Antibody | anti-CCR2 antibody

CCR2 antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCR2, Antibody; CCR2 antibody - middle region; anti-CCR2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Applicable Applications for anti-CCR2 antibody
WB (Western Blot)
Protein Size (# AA)
374 amino acids
Blocking Peptide
For anti-CCR2 (MBS3213873) antibody is Catalog #
Predicted Homology
Based on Immunogen Sequence : Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCR2
Replacement Item
This antibody may replace item sc-30032 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

product-image-AAA200809_WB15.jpg WB (Western Blot) (WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-CCR2 antibody
This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Product Categories/Family for anti-CCR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
UniProt Protein Name
C-C chemokine receptor type 2
UniProt Gene Name
CCR2
UniProt Synonym Gene Names
CMKBR2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2; MCP-1-R
UniProt Entry Name
CCR2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCR2 ccr2 (Catalog #AAA200809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCR2 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Rat, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CCR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCR2 ccr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LIMVICYSGI LKTLLRCRNE KKRHRAVRVI FTIMIVYFLF WTPYNIVILL. It is sometimes possible for the material contained within the vial of "CCR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.