Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201194_WB13.jpg WB (Western Blot) (WB Suggested Anti-CCT2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCCT2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit CCT2 Polyclonal Antibody | anti-CCT2 antibody

CCT2 Antibody - middle region

Gene Names
CCT2; CCTB; 99D8.1; PRO1633; CCT-beta; HEL-S-100n; TCP-1-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCT2, Antibody; CCT2 Antibody - middle region; anti-CCT2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA
Sequence Length
535
Applicable Applications for anti-CCT2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of CCT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCT2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCCT2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

product-image-AAA201194_WB13.jpg WB (Western Blot) (WB Suggested Anti-CCT2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCCT2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

WB (Western Blot)

(Host: MouseTarget Name: CCT2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA201194_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: CCT2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCT2 antibody
This is a rabbit polyclonal antibody against CCT2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.
Product Categories/Family for anti-CCT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
T-complex protein 1 subunit beta isoform 1
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 2
NCBI Official Symbol
CCT2
NCBI Official Synonym Symbols
CCTB; 99D8.1; PRO1633; CCT-beta; HEL-S-100n; TCP-1-beta
NCBI Protein Information
T-complex protein 1 subunit beta
UniProt Protein Name
T-complex protein 1 subunit beta
UniProt Gene Name
CCT2
UniProt Synonym Gene Names
99D8.1; CCTB; TCP-1-beta
UniProt Entry Name
TCPB_HUMAN

Similar Products

Product Notes

The CCT2 cct2 (Catalog #AAA201194) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CCT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCT2 cct2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVDSTAKVAE IEHAEKEKMK EKVERILKHG INCFINRQLI YNYPEQLFGA. It is sometimes possible for the material contained within the vial of "CCT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.